SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0162485 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0162485
Domain Number 1 Region: 155-245
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000366
Family Insect pheromone/odorant-binding proteins 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0162485   Gene: FBgn0136025   Transcript: FBtr0163993
Sequence length 255
Comment type=protein; loc=scaffold_6680:join(10579289..10579466,10579524..10579825,10580506..10580793); ID=FBpp0162485; name=DmojGI13268-PA; parent=FBgn0136025,FBtr0163993; dbxref=FlyBase:FBpp0162485,FlyBase_Annotation_IDs:GI13268-PA,GB_protein:EDW18490,REFSEQ:XP_002008014,FlyMine:FBpp0162485; MD5=cfdb6cb4b86c0cba92115f856b5987ca; length=255; release=r1.3; species=Dmoj;
Sequence
MKITQLLHMLAVIASITSLEYVIRYEAKKKRCLNPPRTARRVESVIRDCQDEVKNKLVTE
AYEILKEQVSQVQPPLHTDDDSVEFIESIDWPPVHSEIHLQHSSEEAPPNASHYEYIVYD
EPEPRRRMARLVRSIKRLDVASAGIYHPTLVPLEDKRIAGCLLHCVYARNNAIDKNGWPT
LDGLVGFYSEGVHEHGFFMATLRSVNLCLRAMTNKYHVSRRDLPQKGESCDLAFDVFDCI
SDQITGYCLDQYSKY
Download sequence
Identical sequences B4KW83
XP_002008014.1.58863 FBpp0162485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]