SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0162729 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0162729
Domain Number 1 Region: 34-154
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.09e-27
Family Insect pheromone/odorant-binding proteins 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0162729   Gene: FBgn0136267   Transcript: FBtr0164237
Sequence length 157
Comment type=protein; loc=scaffold_6680:join(14186412..14186645,14186734..14186884,14187646..14187734); ID=FBpp0162729; name=DmojGI13512-PA; parent=FBgn0136267,FBtr0164237; dbxref=FlyBase:FBpp0162729,FlyBase_Annotation_IDs:GI13512-PA,GB_protein:EDW18946,REFSEQ:XP_002008470,FlyMine:FBpp0162729; MD5=c1db9ae2ba38376f1f3d2a984758c0c4; length=157; release=r1.3; species=Dmoj;
Sequence
MGTARSTSCWHRSWQLLLLLLGLLLLSPKLCDAVTMQQFLQSLDMMRNGCMGKFKVPLDT
LDRLRDGDFSFEPSQDLLCYTKCVAQLAGILTKKGDFSVNKAMAQMPIILPAELQDPAQK
ALNHCKDEPKAHKDQCAQVYYISKCMADYDRPNFKFP
Download sequence
Identical sequences B4KZC0
XP_002008470.1.58863 FBpp0162729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]