SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0163461 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0163461
Domain Number 1 Region: 515-784
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.96e-78
Family Protein kinases, catalytic subunit 0.0000000496
Further Details:      
 
Domain Number 2 Region: 386-508
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-32
Family SH2 domain 0.0000959
Further Details:      
 
Domain Number 3 Region: 40-123,154-214
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-31
Family Pleckstrin-homology domain (PH domain) 0.0015
Further Details:      
 
Domain Number 4 Region: 331-407
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000388
Family SH3-domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0163461   Gene: FBgn0136997   Transcript: FBtr0164969
Sequence length 794
Comment type=protein; loc=scaffold_6500:complement(5448416..5448514,5448582..5448715,5448789..5449561,5449627..5449755,5449825..5449955,5450020..5450100,5450365..5450481,5450567..5450808,5476900..5477046,5478421..5478607,5478729..5478824,5499850..5500098); ID=FBpp0163461; name=DmojGI14244-PA; parent=FBgn0136997,FBtr0164969; dbxref=FlyBase:FBpp0163461,FlyBase_Annotation_IDs:GI14244-PA,GB_protein:EDW11468,REFSEQ:XP_002002026,FlyMine:FBpp0163461; MD5=cf7b3d5af578c4aedd221c88cc83b5c1; length=794; release=r1.3; species=Dmoj;
Sequence
MLSSKMQRSSHGSMKSSLSLRSSSKSFQAKMDKMSEHLYDIVKSGSMVKRAQNKKRFTPV
NYKHRWFELTKRTFCYYDVENVERRRERGRINLKGVRLVEEATVSGEGGDPFAPDGYPFQ
VGYCETTSTTAAQQQAAEQQHLGEGQHLVGRAVPQYTLYVIANSEKERSEWIRAIRQVCE
DTNTPKSYRYHPGLWSGKKWSCCKGTARSTFGCRAAAHWREANNNPSNGSSPAQNSTRSI
SPNNSTTNSQFSLQHNSSGSLGGSGVGGVGVGGGIAVGVGGVGAGLNSSNGVGGGGGNCT
PTSLQPQSSLTTFKQSPTLLNGNGALLDANMPGGIPTPGTPNSKAKDNSHFVKLVVALYP
FKAIEGGDLSLEKNAEYEVIDDSQEHWWKVKDALGNVGYIPSNYVKPKALLGLERYEWYV
GDMSRQRAESLLKQGDKEGCFVVRKSSTKGLYTLSLHTKVPQSHVKHYHIKQNARGEYYL
SEKHCCETIPDLINYHRHNSGGLACRLKSSPCDRPVPPTAGLSHDKWEIHPMELMLMEEL
GSGQFGVVRRGKWRGSIDTAVKMMKEGTMSEDDFIEEAKVMTKLQHPNLVQLYGVCSKHR
PIYIVTEYMKHGSLLNYLRRHENTLIGNMGLLLDMCIQVSKGMAYLERHNYIHRDLAARN
CLVGSENVVKVADFGLARYVLDDQYTSSGGTKFPIKWAPPEVLNYTRFSSKSDVWAYGVL
MWEIFTCGKMPYGRLKNTEVVERVQRGIILEKPKSCAKEIYEVMKKCWSHGPEERPSFRV
LKDQLALVAQTLTD
Download sequence
Identical sequences B4KJM3
XP_002002026.1.58863 XP_017859157.1.65068 FBpp0163461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]