SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0163901 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0163901
Domain Number 1 Region: 421-515
Classification Level Classification E-value
Superfamily SH2 domain 1.08e-23
Family SH2 domain 0.0006
Further Details:      
 
Domain Number 2 Region: 536-585
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000106
Family SOCS box-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0163901   Gene: FBgn0137435   Transcript: FBtr0165409
Sequence length 608
Comment type=protein; loc=scaffold_6473:complement(14432240..14432402,14432483..14432590,14432657..14432747,14432852..14433020,14433454..14433563,14433627..14434812); ID=FBpp0163901; name=DmojGI14684-PA; parent=FBgn0137435,FBtr0165409; dbxref=FlyBase:FBpp0163901,FlyBase_Annotation_IDs:GI14684-PA,GB_protein:EDW07755,REFSEQ:XP_002010438,FlyMine:FBpp0163901; MD5=c7107e4d1e3f9d4224e92b3b4c62b5cd; length=608; release=r1.3; species=Dmoj;
Sequence
MSHDALFTREISDFYNVPIDSDIYAFPVDMIEQQLEKQQLEQQQLEKQQQPLEKPQQSVA
YHKASSRRNKRNKRKQRYAAAAAAAAAAAAAAGSTTVVETSDDGGDKSGKHGKYRTPVVQ
SGEAEPLHMTLDEVKQFYHTLYSDAGKSSWCGASGAAGNKMLGTAAAGVGSKALGVKSSN
ETIWSMSTNTTNTTNTTTTTARTRSSAGTTRASGGGAASSDTTAKYLSKQSKHNIDNDKL
NNNNNNNNSSSNNYAQQQQLPSAAAAAAAGSTTQLPNSSEKLLAEQQQPNNNKHLLQSEK
KSQFSLNLKQKFCSIFRFRRSNHSRCRSSNASVAAAAAASAGAATATAAAVSATAATTDA
ADAEEANNQCLSRSEPSADLRKKFQSRALPPLPRKAYAIDAAEAEPEEQKKSAGAQEPRA
LQFTSSIEKVKDYGWYWGPLSSEAAEKVLSNEPDGSFIVRDSSDDHYIFSLSFKLNNCVR
HVRIEQDQGTFSFGSYAKFKSQTITEFIEKAVEHSRSGRYLFFLHRRPEHGPMRVQLTNP
VSRFKHVQSLQHMCRFVILKAVIRKDLIQTLPLPRRLLDYLNYKHCYSEQVESDSSHSQV
SRHRYIYS
Download sequence
Identical sequences FBpp0163901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]