SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0164278 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0164278
Domain Number - Region: 61-123
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0126
Family beta-sandwich domain of Sec23/24 0.024
Further Details:      
 
Domain Number - Region: 441-481
Classification Level Classification E-value
Superfamily SH2 domain 0.0783
Family SH2 domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0164278   Gene: FBgn0137811   Transcript: FBtr0165786
Sequence length 493
Comment type=protein; loc=scaffold_6473:complement(5275152..5275400,5291524..5292010,5298713..5299458); ID=FBpp0164278; name=DmojGI15061-PA; parent=FBgn0137811,FBtr0165786; dbxref=FlyBase:FBpp0164278,FlyBase_Annotation_IDs:GI15061-PA,GB_protein:EDW07071,REFSEQ:XP_002009754,FlyMine:FBpp0164278; MD5=20e4901d6d052f64218ba5a2a551132c; length=493; release=r1.3; species=Dmoj;
Sequence
MSQELTSNVTNSMDTMEDTSKVEVIVYTKSDKTLKQNMNAKDDTLRKRTSLIIVPQQVDD
LLDAAAVQQQEQRQEQQQQQQQLQLQHQQQQQLTENGNRNSIASMDSCVSTNTSQSNQSS
VSSSSSTSSEDAHAAYQDLQNGNGADELAAMHSPGCSSTSESTSCSSSVDYSLREQLHNY
ANRSEEQLKCINHHELPTAAQLLKGMSLPMEQAASGAAAHCDALLSPQEVPLGRRYAEVA
QFKGHSKARSNEQQLTSAAAAVGVAAPLTDKTEAVVAAVKCSNNGNNNNNNHNNNSSNNN
GNGSSCNNAAQQSQKSQLQQSSNNSNKLNGQSNLSSNNNNNNSSSNSNNNNNNKMISNSQ
MDGKNGDSRRSSSLEPDADDVVDLAHGGAFDDDMQALLPKCTRRSRDELSQSRTSLVSSS
EGGILAEGETSSEESSRDSSNDSPPCDLGLMERLLLTHPMWFLPGIQRSGAVHLLQGKEE
GVSVDNYEYIDSA
Download sequence
Identical sequences FBpp0164278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]