SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0164727 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0164727
Domain Number 1 Region: 98-202
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000157
Family Insect pheromone/odorant-binding proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0164727   Gene: FBgn0138259   Transcript: FBtr0166235
Sequence length 220
Comment type=protein; loc=scaffold_6473:join(4850679..4850873,4851427..4851894); ID=FBpp0164727; name=DmojGI15510-PA; parent=FBgn0138259,FBtr0166235; dbxref=FlyBase:FBpp0164727,FlyBase_Annotation_IDs:GI15510-PA,GB_protein:EDW07030,REFSEQ:XP_002009713,FlyMine:FBpp0164727; MD5=bebccef566df2780c8c08c26927b2f9f; length=220; release=r1.3; species=Dmoj;
Sequence
MIVASNNNQSGNGNGNGYGYGYQRCVCRSNDQLSLISAYPDVAQCCSIGGPKMTFVRMLI
LMPLLLSLLANCGPLALPPPPPPPPPTPSARSAQSLAILRARDQCFRSERISPNQRLALD
RQQYSNVPYVHRYVYCFWTRLQLWHDGTGFDPMRIVESFGGPRRLNLEQTVPAINGCNAH
ARRSARTALDWCYGAFVCVLRTAVGDWYRHHMQDVINGNA
Download sequence
Identical sequences B4L3A2
FBpp0164727 XP_002009713.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]