SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165296 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165296
Domain Number 1 Region: 624-937
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.98e-81
Family p120GAP domain-like 0.0000000826
Further Details:      
 
Domain Number 2 Region: 81-173
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-25
Family SH2 domain 0.00055
Further Details:      
 
Domain Number 3 Region: 214-340
Classification Level Classification E-value
Superfamily SH2 domain 1.08e-23
Family SH2 domain 0.00084
Further Details:      
 
Domain Number 4 Region: 504-637
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.03e-20
Family PLC-like (P variant) 0.027
Further Details:      
 
Domain Number 5 Region: 381-486
Classification Level Classification E-value
Superfamily PH domain-like 2.62e-20
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 
Domain Number 6 Region: 173-234
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000302
Family SH3-domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165296   Gene: FBgn0138828   Transcript: FBtr0166804
Sequence length 954
Comment type=protein; loc=scaffold_6328:complement(3366781..3366929,3366992..3367142,3367203..3368109,3368302..3369151,3369481..3369890,3370169..3370241,3370326..3370439,3372058..3372268); ID=FBpp0165296; name=DmojGI16079-PA; parent=FBgn0138828,FBtr0166804; dbxref=FlyBase:FBpp0165296,FlyBase_Annotation_IDs:GI16079-PA,GB_protein:EDW06133,REFSEQ:XP_002011291,FlyMine:FBpp0165296; MD5=8fb81a8d39410437b3567ca686d6a86d; length=954; release=r1.3; species=Dmoj;
Sequence
MADLMRLGNVDVVIQKDKLGSPTGGSDDGNLAALGGITGLGAMMAAGGIDLNDLAQELDQ
DEFDGPHMLNGERPAIIAPPESEWYHGRLDRYSAEARLRGSGKLGSYLVRESDRKPGSYV
LSYCGRTGINHFRITAVCGDFYIGGRQFISLSDLVGYYTSCSDLLKRERLVIPVAPPEPV
NDKKRVVAILPYTKMPETDELSFQKGDIFFVHNDMGDGWLWVTAHRTGEQGMIFRELVDD
LDVSIDPNTVFPWFHPNCTKNEAVDMLVKAGPGSFLVRPSDNSPGDYSLFFHINNQIQRF
RIEKKGVRYLMGGRTFECLDAVINRYRKEQIVEGHSLNHPVVNGSQPEFNQQYVVEKAAE
KIYATLRECRDQIGLKKIKGIKHHGHLNKKSDKTTKWKQLYFALINDGTETQLCFYDNPK
KTKPKGLIDLSCAYLYQCHDSLWERPYCFQIVERALPCLATVTYLCAPSQESYVEWINAL
KAQCDSQLSRAQKKVSRLRELRCLNLHVLEAHRLPFKLVPHPYCSISLNQVKVGKTRVKI
APEPVWEEEFVLDDVPPDVVSLTITVVSRGKRGKDSEVAELTIDLASLKNGQETEDWYKL
TGMTPMGEWGSLRLRMRYLDDLIMPCEEYSPLQQLLLEPELHAVKALAELCHNDRVPLAT
ALLRVFRHEKRETELIRILCQAEVARENETTTLFRGASLATTLMDLYMRTECSGFLQSAV
SETVQRILESKQSAELNPTKMDVNDDACTNAEFLLQILDLVTQSIFTSPDACPRNVRYIC
NCLQKAVVAKWPTERLVRTRVVSGFIFLRLLCPSLLNPRQFGLVSETPPTAATRSLIMVA
KCLQNLANLIEFGGKEQYMEVVNPFILKNKERMIVFLDQLSQVTDPNPPFVMFSEQNTNH
NVQDTGRELATLHHICVSYLPELQELSHIISIKKLVTVTDMLSKHKLKYREMIS
Download sequence
Identical sequences B4L6Y7
FBpp0165296 XP_002011291.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]