SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165383 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165383
Domain Number 1 Region: 1401-1511
Classification Level Classification E-value
Superfamily SH2 domain 1.75e-26
Family SH2 domain 0.00099
Further Details:      
 
Weak hits

Sequence:  FBpp0165383
Domain Number - Region: 2-38
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0777
Family PHD domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165383   Gene: FBgn0138915   Transcript: FBtr0166891
Sequence length 1517
Comment type=protein; loc=scaffold_6328:complement(1932917..1933103,1933179..1933298,1933377..1933560,1933888..1937073,1939309..1939732,1948888..1949022,1949918..1950235); ID=FBpp0165383; name=DmojGI16166-PA; parent=FBgn0138915,FBtr0166891; dbxref=FlyBase:FBpp0165383,FlyBase_Annotation_IDs:GI16166-PA,GB_protein:EDW05995,REFSEQ:XP_002011153,FlyMine:FBpp0165383; MD5=f9448c70535782369c4250722ecb526c; length=1517; release=r1.3; species=Dmoj;
Sequence
MFCRRCWIDFTAGEEDYVVCAGPCAWPYHATCAAVPRELARELRRSSSNNFDTNFPSFGF
GLGLGLGLGSGSGLGPNAGSGSSSGSGSEWYCHNCRQLYRLQLFFEIAICDDYSLPVDFV
KKRPSSFDPCLAEAIPTNPEHWIAPSPQTEFQQQQQQQQQQLHAHNNNTLPAAPQQQQRG
TLQHPPLPNSNIKQASVKLIEGYSDPKDTRHHGQHKKVYHKKAKRRSAPLHKQRQHQQQQ
QLQTLPTPRGHQQQLQQQQQQQQQQQLLHRHSTYNNNNGNHKKDKRNSHYNSDSSAPKSS
DEEADIDEEVERAAPPTAAAAGTGTGAGAAAGDLLNSPDSISDDLVRPLPAQLQRSPRKL
TVAQAEHSKRQPSPYYYSDLLKTRDKEEEGRKPTLERDREAKQKCRQSTASEPPQQTLTQ
PHRLGGYRKSSSLDAPQSQQQQQQQQQQQQQQQQQQQEEQLLQKGDDAELDNDPVELEEA
TCLTEQSTPKRYSFTEEGVRIIRCETPSTSTSEESDCSECLKRREWHARALALVRKTCNV
QPRQQLPIGSGELQLQLQHCDAGEGELLKCCPPATGGGGVVGVGVGDLACESMPPHRLLG
PAAVCGACIPTPNKTIGLGHGDEDQLDELEEYFRPRSIFYVHPHGVHECVECAPPIKLEE
QQQQQTAGAKEQEEQQQQQQQQEEEEEQEQEEEGEEYDSDNMASRRRQIYETAFDCKIAK
SDDDLDEVDRITNHSVLLQLNSSSNSNGNELSVPSKSLSKSRLECKRAKNSKNQALQQQQ
PQQQQQQQQQQLQQQQQQQQQQQESPDGQCQVVLQVQAELSQLQLSQTADQQNQNQQQQQ
QQQQQQQQQQQQQLPTRGYTPSPPSTAPLPIKFPGKHERYMNSIKSAPNLPATQPAHPRL
RDLRLPLQASLRQHQQHQQQQQQQLQLCASSNDNSLTDSAYVNPPSTNSNSNSNSAVAST
SASSRRPRSFVLESGRVLELRRSAHHHHHQQQQQQQQQQHAQQQHGKQQQQQHLPKPRHN
YSSTESIATSSSGGSMESLRSSTSEGNRSTSSSESRHSSSLSSHSSESSNSNSNSNSASA
SASASASASASSSVAYPLRAPVLLHSKLHILSPISDKSSQEPASEQSQQPATAAAGAASL
QQEEASAEAAAAAAAAAGSSSVPVQLLVKQQRSGSQRAAAAAAAAAPNKALLHLADELLG
SDSGISLHSREDGKPTTLALQRLTLPKLQLGNGSAADTSSSAAAGISSAATAAGGGGGAA
GSSALPQELRDLPFDMPKLRRRKTLQQEAACTSGSATSVDLGDLPFDMPKLRRRLRANQA
EINNLLMHSTESSGISQASSSHSMRDEQKLASKLDTALFRQNLTLNLNEPRQVNKQFGSL
DLRGLSSHKELNMNLGQGYVTAVDLIDVTIPLERQGWYHGAITRIEAETTLRPLAEGSFL
VRNCESTKQDYSLSLKGAKGFMHMRIQRNEAGQYILGQFSRPFETVPDMIRHFCLNRLPV
RGAEHMCLIEPVIAQLL
Download sequence
Identical sequences FBpp0165383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]