SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165457 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165457
Domain Number 1 Region: 56-166
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000209
Family Insect pheromone/odorant-binding proteins 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165457   Gene: FBgn0138989   Transcript: FBtr0166965
Sequence length 177
Comment type=protein; loc=scaffold_6328:complement(616562..616777,616833..617150); ID=FBpp0165457; name=DmojGI16240-PA; parent=FBgn0138989,FBtr0166965; dbxref=FlyBase:FBpp0165457,FlyBase_Annotation_IDs:GI16240-PA,GB_protein:EDW05855,REFSEQ:XP_002011013,FlyMine:FBpp0165457; MD5=153083c8fc380d48d66d264cc96090b9; length=177; release=r1.3; species=Dmoj;
Sequence
MHSTLLSLLALASGIWVQCSMAEPQIKGQQLPQFDLTRLFGGRSSVPLVTLLDRNLPEVQ
QMIDRTKKSCLQKLRMPAVQRSLIREPNPTEQEKCLLECVLKGIQIMDDSTNKLNLRRVE
QLTSLVTEDNKVAMALSSSLAQSCNRSVSTQKPCEAAHQLNQCIGRQMERNRVKLHW
Download sequence
Identical sequences B4L659
FBpp0165457 XP_002011013.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]