SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165524 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165524
Domain Number 1 Region: 24-137
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.57e-24
Family Insect pheromone/odorant-binding proteins 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165524   Gene: FBgn0139055   Transcript: FBtr0167032
Sequence length 142
Comment type=protein; loc=scaffold_6328:join(614801..614863,614939..615106,615178..615375); ID=FBpp0165524; name=DmojGI16307-PA; parent=FBgn0139055,FBtr0167032; dbxref=FlyBase:FBpp0165524,FlyBase_Annotation_IDs:GI16307-PA,GB_protein:EDW05853,REFSEQ:XP_002011011,FlyMine:FBpp0165524; MD5=5c66a6d268c8ca0f798a51289ac9721f; length=142; release=r1.3; species=Dmoj;
Sequence
MQYLQLIIGSLLVSLPFCRPGATEDQMWAAGKLMRDVCLPKFPKITTEIADGIQKGILPD
DKDAKCYINCIMEMMQTMKKGKFMVESTLKQVELLMPESYKASYRKGISECKDAAVGIKN
NCDAAHAQLTCFRSKIEIFVFP
Download sequence
Identical sequences B4L657
XP_002011011.1.58863 FBpp0165524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]