SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165525 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165525
Domain Number 1 Region: 56-152
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000000072
Family Insect pheromone/odorant-binding proteins 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165525   Gene: FBgn0139056   Transcript: FBtr0167033
Sequence length 157
Comment type=protein; loc=scaffold_6328:join(615659..615824,615899..616121,616223..616307); ID=FBpp0165525; name=DmojGI16308-PA; parent=FBgn0139056,FBtr0167033; dbxref=FlyBase:FBpp0165525,FlyBase_Annotation_IDs:GI16308-PA,GB_protein:EDW05854,REFSEQ:XP_002011012,FlyMine:FBpp0165525; MD5=ce085a5b1b0df44de4a93d42c053b383; length=157; release=r1.3; species=Dmoj;
Sequence
MMMMLQRTCLTMLLLTLLTLAQADDQKEEDTAMSLSEVVEMVEPFGNGCEPKPERSHIEE
MVLNKEDASHESKCFRRCMLKQFEIMGEGQMQFDEAKTVDMMNMMFPDKEANSKAIAAKC
NQAPNGITDECEVCHAISMCMLREMRAASYKIPEVKE
Download sequence
Identical sequences FBpp0165525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]