SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165526 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165526
Domain Number 1 Region: 10-143
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.49e-29
Family Insect pheromone/odorant-binding proteins 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165526   Gene: FBgn0139057   Transcript: FBtr0167034
Sequence length 145
Comment type=protein; loc=scaffold_6328:join(619199..619337,619393..619481,619543..619679,619755..619827); ID=FBpp0165526; name=DmojGI16309-PA; parent=FBgn0139057,FBtr0167034; dbxref=FlyBase:FBpp0165526,FlyBase_Annotation_IDs:GI16309-PA,GB_protein:EDW05856,REFSEQ:XP_002011014,FlyMine:FBpp0165526; MD5=d363103ca9a3c2850ec1e00c91d917d1; length=145; release=r1.3; species=Dmoj;
Sequence
MSRFVCLSVLVLLAAVAVSCKPHEDYDKEHIAEVAEECKTESGATDEDVEHMMQHEPADS
HESKCLRACMLKKFEIMNDEGKLSKENALEMVKLSSKDDAEKEAAAAEIVDKCEGIEVPE
DHCDAAAAYEKCIIDHMHEHGLALE
Download sequence
Identical sequences B4L660
FBpp0165526 XP_002011014.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]