SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165891 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165891
Domain Number 1 Region: 346-450
Classification Level Classification E-value
Superfamily SH2 domain 9.96e-26
Family SH2 domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165891   Gene: FBgn0139422   Transcript: FBtr0167399
Sequence length 481
Comment type=protein; loc=scaffold_6654:complement(210370..210573,210629..211005,211096..211372,216050..216152,216302..216786); ID=FBpp0165891; name=DmojGI16674-PA; parent=FBgn0139422,FBtr0167399; dbxref=FlyBase:FBpp0165891,FlyBase_Annotation_IDs:GI16674-PA,GB_protein:EDW17112,REFSEQ:XP_002011981,FlyMine:FBpp0165891; MD5=1d649428367692b60fc9dc4f62674dad; length=481; release=r1.3; species=Dmoj;
Sequence
MITNNNLDYEKSCLPIAARPTATATATATSVAGTAATIASGNSNSNGSASSSNNSSPTAD
NHNNTHSHSISNSNGGSYFNRFDNRIAANLAAVITGARFRSSSCNSRQQQTQPPPVHHTT
RTSYHYLSASRGRSTLSNATPTSPASLGRRRPLQLFSQANLNCNDNEKGAHTPSSDEDNS
PTELNSCKRLTDKPPLVKRLTMGLLRHNEESRPLVANVTPLSAAALSCEHAGPIYSNGYI
NEDSYIDSKFGDSCRQSLTAIPMLDNVSLNNDNSEFNLKKRYLRETSSANSSPKIFANRL
RFNNASATAAAAAAAATSLAATQRSSSLANTHTARDNAEEESDTELKAASWYQAGISRDI
AVEVLQNKSPGAFLVRKSSSRPDCYALTLRVPSPPGPKVANYIILRSPRGYKIKGFRKEF
SSLKALITHHSVMPELLPVPLAMPRPTNMSSSRRNLDDFDTYDSLQMLLKYLRAKNLETE
Q
Download sequence
Identical sequences B4L9R4
FBpp0165891 XP_002011981.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]