SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165923 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165923
Domain Number 1 Region: 238-337
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-18
Family SH2 domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165923   Gene: FBgn0139454   Transcript: FBtr0167431
Sequence length 375
Comment type=protein; loc=scaffold_6654:join(262243..262341,270126..270383,270454..271224); ID=FBpp0165923; name=DmojGI16706-PA; parent=FBgn0139454,FBtr0167431; dbxref=FlyBase:FBpp0165923,FlyBase_Annotation_IDs:GI16706-PA,GB_protein:EDW17113,REFSEQ:XP_002011982,FlyMine:FBpp0165923; MD5=aa439bf167a03a58ca929b017aced3e1; length=375; release=r1.3; species=Dmoj;
Sequence
MGRLFQYNRFGATDNVNKLKKDTQKKTHDKTKMLRNAINCPGYSDIYGTNAGKNLDLAFK
KGQQWSNKLQPAVATVTAEEPAQSRTHKVYDSMKNFLQRKLFAQPSRVECEEPTSDYDED
LLDSSYQADAETDEEAELLAICSCNSTPSSTPKRVNKSPQKSLLSLNCWQSSQPSDSSGN
EEVTAEDQDESDAGISDCCQLLNENSSSASRRRSTPRKRATPRFSTHSNNTDDDEDADED
PELLQCAWYQPRITLKAAQEHLQSATPGCFILRRSTPRSFELCLRLEHKVKCYAVQCSRS
EMYSLKGAPKQFSTLKALITHHSVMAEQLPLTLDMPREQDLVKTSAMRYADDFEPLESLQ
LLGILKSLQAKSYEA
Download sequence
Identical sequences B4L9R5
FBpp0165923 XP_002011982.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]