SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165925 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165925
Domain Number 1 Region: 283-384
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-26
Family SH2 domain 0.00086
Further Details:      
 
Weak hits

Sequence:  FBpp0165925
Domain Number - Region: 75-123
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0654
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165925   Gene: FBgn0139456   Transcript: FBtr0167433
Sequence length 425
Comment type=protein; loc=scaffold_6654:join(306553..306740,306794..307103,310108..310381,310470..310750,310976..311200); ID=FBpp0165925; name=DmojGI16708-PA; parent=FBgn0139456,FBtr0167433; dbxref=FlyBase:FBpp0165925,FlyBase_Annotation_IDs:GI16708-PA,GB_protein:EDW17114,REFSEQ:XP_002011983,FlyMine:FBpp0165925; MD5=381997e25ded74eeb6cfb0ae5b0bfcd9; length=425; release=r1.3; species=Dmoj;
Sequence
MQDIRLRLEPQHNTAAFTNSPAEATSSAATLVNAEAALIETGERKGSAEGSPLVQLLPEL
SFSAPTASSTVHYYQHQHQHQPHSHQHPHQHSHSHSHSHSHPVQPRSTPRHQVEQLQLLH
SHHTAHSQHNGQELGEQQMPRSPSSEEDNSPTEMNNCRRLVDKPPLVKRLTMGIGLLRGT
EDSRPLVHNTCSSSLNSGSSQTISDGYVNEAICEPDKYVASKFGDSCRQSLTALETATQR
LQSELPNSKKYLRETCSANSSPKLFAASSPLRLDNLSLAEQQELKGAAWYQAGIPREISL
EVLSRQSPGAFLVRQSSTKPGCFALSLRVPPPAPRVAHYLILRTQRGYKIKGFTKEFSSL
RALITHHSVMPELLPVPLTLPRPPHIRAHTQNYGHGGGNGNGGGGDFEMYGSLNDFRKMM
ADLNV
Download sequence
Identical sequences B4L9R6
FBpp0165925 XP_002011983.1.58863 XP_015015787.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]