SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0165927 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0165927
Domain Number 1 Region: 360-629
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.6e-86
Family Protein kinases, catalytic subunit 0.00000000215
Further Details:      
 
Domain Number 2 Region: 222-333,363-389
Classification Level Classification E-value
Superfamily SH2 domain 3.87e-37
Family SH2 domain 0.00000921
Further Details:      
 
Domain Number 3 Region: 184-227
Classification Level Classification E-value
Superfamily SH3-domain 0.0000182
Family SH3-domain 0.00049
Further Details:      
 
Weak hits

Sequence:  FBpp0165927
Domain Number - Region: 1371-1439
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.034
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0165927   Gene: FBgn0139458   Transcript: FBtr0167435
Sequence length 1591
Comment type=protein; loc=scaffold_6654:join(329439..329790,346292..346814,346878..347293,347365..347951,348216..348465,348530..348638,348683..348759,349876..350432,350472..351940,352025..352460); ID=FBpp0165927; name=DmojGI16710-PA; parent=FBgn0139458,FBtr0167435; dbxref=FlyBase:FBpp0165927,FlyBase_Annotation_IDs:GI16710-PA,GB_protein:EDW17117,REFSEQ:XP_002011986,FlyMine:FBpp0165927; MD5=f44b3497fb7497b3b200be555b17b357; length=1591; release=r1.3; species=Dmoj;
Sequence
MGAQQGKERGSHSSGGAGGGTVSCIGVGTSSSPVASGSPHCISGGNSGASVGGLSSNSTL
RNSRMKSHQSSVHGSINSSGSSAHRSGGGGGGGGSSANHKDNRCNPSVGLNIFTEHNEAL
LQSRPLPHIPASTAAALLADAAELQSQDSPVLTSLGGVHSSATSVFESAHRWTSKENLLA
PGPEEDDPQLFVALYDFQAGGENQLSLKKGEQVRILSYNKSGEWCEAHSDSGNVGWVPSN
YVTPLNSLEKHSWYHGPISRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHY
RISEDPDGKVFVTQEAKFNTLAELVHHHSVPHEGHGLITPLLYPAPKQNKPTVFPLSPEP
DEWEICRTDIMMKHKLGGGQYGEVYEAVWKRYGNTVAVKTLKEDTMALKDFLEEAAIMKE
MKHPNLVQLIGVCTREPPFYIITEFMSHGNLLDFLRSAGRETLDAVALLYMATQIASGMS
YLESRNYIHRDLAARNCLVGDNKLVKVADFGLARLMRDDTYTAHAGAKFPIKWTAPEGLA
YNKFSTKSDVWAFGVLLWEIATYGMSPYPGIDLTDVYHKLEKGYRMERPPGCPPEVYDLM
RQCWLWDATERPTFKRIHHALEHMFQESSITEAVEKQLNATATASGGSGSNSGSISAAAA
GVAPPTATASASSSASASLSLTPQMVKKSLANVDQQQQQQQQLASTPMSETGSTSTKLST
FSSQGKGNVQMRRTTNKQKPQAEHINLLSSSRDSTYREEDARNLIDELNTNGLTRDINNL
TQRYDSEADTAADPDTDATGDSIEQSLTTITPPNKMQHSLHAGVSNLTGGIGPRSSQQHS
SFKRPVMGNRGLETRQSKRSQQPAPINVTTNGNASTPVLPAHPITVGALEVMNVKRVVNR
YGTLPKGARIGAFLDSLEDSSSSNSSGAGTGSEAPVNGHTTPAANTAAAATGRAQPAVPQ
QMIRSNSSGGVTMQNNAAASLNKLQRHRTTTEGTMMTFSSFRAAGSSSSPKRSGITQPAL
ANLEFPPPPLEEFEALPPPPPPPAPESAVQAIQQHLHAQHSSSNDVSNTAPSVEEASSRF
GVSLRKREPSTDSCSSLGTPPEASVSAATAAAEEKSLNLKEKLITEIKSAGKPSDPSIGY
TNGGTPVVVDPVAQLVTELAESMNLPKPSKLTNGNCSTNTNNSNTNSNNNNFKAQLKKVE
PKKLNTPIPKSDQPTNIIDFKAHLRKVDKVEQQQPKEQSLQQQQQQSPNANCNTARRDET
KKFSAANQKTEIKIDVSNSNADTDGGDTGTGTGTGNSSDGGKRRSTGSINSLKKLWEQPS
GDYASTTIPQTMATSNGGGASAQLSPKYGFKAIQQPLGNLTGNSKVFGNKPPPAAPPPPP
PISSTPSTTAQSKPAVAATTKLATTAIKTSLSTQLFTDAEGSSSNEEQHQQTGDQAELMT
QSLYSDHNSQNKPAVPHKPTKLTIYATPIAKIAGIGVDGDNINSTQISRESILELVTLLE
GSLKHPVNSISASQWLQLSDKLNILQNSCVVFAENQSMPPHSKFHFRELVTRVETQSQHL
RTAGSKNVQDNERLVGEVGQSLKQISNALHR
Download sequence
Identical sequences FBpp0165927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]