SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0166705 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0166705
Domain Number 1 Region: 30-142
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.62e-23
Family Insect pheromone/odorant-binding proteins 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0166705   Gene: FBgn0140232   Transcript: FBtr0168213
Sequence length 143
Comment type=protein; loc=scaffold_6500:12670741..12671172; ID=FBpp0166705; name=DmojGI17488-PA; parent=FBgn0140232,FBtr0168213; dbxref=FlyBase:FBpp0166705,FlyBase_Annotation_IDs:GI17488-PA,GB_protein:EDW12076,REFSEQ:XP_002002634,FlyMine:FBpp0166705; MD5=a7185f1f625d61136c2d2956af4fe0dd; length=143; release=r1.3; species=Dmoj;
Sequence
MQRFVYSVACVALLGAALIAAFDEKEALAKFVEKAEQCKDEVGASDAEVQTIVKHEAAST
YEGKCLRACIMKSFHVLGENGKLDVEAGREKAKQYTGSDPAKLEMALEIGDICAAIPVPD
DHCEAAEKYSLCFKSEAHKRGLI
Download sequence
Identical sequences B4KFV0
FBpp0166705 XP_002002634.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]