SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0167754 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0167754
Domain Number 1 Region: 21-128
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 9.03e-27
Family Insect pheromone/odorant-binding proteins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0167754   Gene: FBgn0141276   Transcript: FBtr0169262
Sequence length 132
Comment type=protein; loc=scaffold_6496:complement(21000963..21001310,21001370..21001420); ID=FBpp0167754; name=DmojGI18537-PA; parent=FBgn0141276,FBtr0169262; dbxref=FlyBase:FBpp0167754,FlyBase_Annotation_IDs:GI18537-PA,GB_protein:EDW10435,REFSEQ:XP_002006500,FlyMine:FBpp0167754; MD5=14fe30b7387ca992afe3522a662bcb07; length=132; release=r1.3; species=Dmoj;
Sequence
MKYLIVLVACVALVAADELQLSDEQKARAKANAGACIEQEGVTKEQAMALREGKFENVDE
KVKCFANCFLEKSGLLADGQIKSDVVLEKLGPIVGVDKVKAAQEKCDSLKGSDKCDTGFQ
LYQCYYKQRTQI
Download sequence
Identical sequences B4KRK9
FBpp0167754 XP_002006500.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]