SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0167755 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0167755
Domain Number 1 Region: 16-43,86-156
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000107
Family Insect pheromone/odorant-binding proteins 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0167755   Gene: FBgn0141277   Transcript: FBtr0169263
Sequence length 236
Comment type=protein; loc=scaffold_6496:complement(20996216..20996926); ID=FBpp0167755; name=DmojGI18538-PA; parent=FBgn0141277,FBtr0169263; dbxref=FlyBase:FBpp0167755,FlyBase_Annotation_IDs:GI18538-PA,GB_protein:EDW10434,REFSEQ:XP_002006499,FlyMine:FBpp0167755; MD5=8b5a0b91d387815ada5da818c8d71a6b; length=236; release=r1.3; species=Dmoj;
Sequence
MSLTRSVLDEQTVTRQQAKLSQDLLQSCMRETEISMSQLKFFRLSLLFNDNNNSDNELAI
APVDGEAELNAVNNAPEMDYVSGSPYLDMKRNEPLQCFVRCLYESLGIMHYDMMLEEAFK
MQLDNLMQRLKPELKECKNMKSRNRCEAAYKLHLCYNHLKNLDTEQRLREMLERTETNSD
LPDTEENETDNDNETQNENESDNENIVSATDKANEIIDAMQRISDAAEAAAAAAEA
Download sequence
Identical sequences FBpp0167755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]