SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0167756 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0167756
Domain Number 1 Region: 28-134
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 6.93e-19
Family Insect pheromone/odorant-binding proteins 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0167756   Gene: FBgn0141278   Transcript: FBtr0169264
Sequence length 138
Comment type=protein; loc=scaffold_6496:complement(20994797..20995153,20995212..20995271); ID=FBpp0167756; name=DmojGI18539-PA; parent=FBgn0141278,FBtr0169264; dbxref=FlyBase:FBpp0167756,FlyBase_Annotation_IDs:GI18539-PA,GB_protein:EDW10433,REFSEQ:XP_002006498,FlyMine:FBpp0167756; MD5=1974cce6cbaef47fa01f549778557d58; length=138; release=r1.3; species=Dmoj;
Sequence
MKVNIFVQVLIVCSFYELADSQSAADLAAYAKKQQECIKELKIPANEATQITANKDVSNP
SAAYKCYHDCLYKKMGLMAPDGKANDERIVKYAQARFSAPVDKIKTKLTDCMTGVKKVPN
ACEHIYNLELCMSKALTA
Download sequence
Identical sequences B4KRK7
FBpp0167756 XP_002006498.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]