SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0167890 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0167890
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000017
Family Insect pheromone/odorant-binding proteins 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0167890   Gene: FBgn0141412   Transcript: FBtr0169398
Sequence length 118
Comment type=protein; loc=scaffold_6496:complement(18418751..18419107); ID=FBpp0167890; name=DmojGI18673-PA; parent=FBgn0141412,FBtr0169398; dbxref=FlyBase:FBpp0167890,FlyBase_Annotation_IDs:GI18673-PA,GB_protein:EDW10183,REFSEQ:XP_002006248,FlyMine:FBpp0167890; MD5=f57267b592950855dd228c11795c3bcb; length=118; release=r1.3; species=Dmoj;
Sequence
MEVEDKCLTENNTTRMDLYAKIDQAKTEGHFENIEMKYMCYVHCAAAELEILDANEQLDI
EVFKTMEHLMEENAAVIEECHRVISLVEDKCAYAFQMLVCYIKSYRRVDYISIAPGKQ
Download sequence
Identical sequences FBpp0167890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]