SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0168179 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0168179
Domain Number 1 Region: 647-913
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-73
Family Protein kinases, catalytic subunit 0.00000194
Further Details:      
 
Domain Number 2 Region: 103-278
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.52e-35
Family Ankyrin repeat 0.00058
Further Details:      
 
Domain Number 3 Region: 9-109
Classification Level Classification E-value
Superfamily SH2 domain 4.85e-26
Family SH2 domain 0.00048
Further Details:      
 
Domain Number 4 Region: 270-410
Classification Level Classification E-value
Superfamily SH2 domain 7.54e-21
Family SH2 domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0168179   Gene: FBgn0141701   Transcript: FBtr0169687
Sequence length 931
Comment type=protein; loc=scaffold_6496:complement(13272235..13272728,13272804..13273989,13274052..13274588,13274644..13275060,13275337..13275413,13275510..13275594); ID=FBpp0168179; name=DmojGI18962-PA; parent=FBgn0141701,FBtr0169687; dbxref=FlyBase:FBpp0168179,FlyBase_Annotation_IDs:GI18962-PA,GB_protein:EDW09574,REFSEQ:XP_002005639,FlyMine:FBpp0168179; MD5=2e0fc6577f3bcd7b081b9a8dea94780a; length=931; release=r1.3; species=Dmoj;
Sequence
MAAYPRDDQMKWYHGRLTREAADDLLKQGCEDGTFLVRESSTAAGDFVLSLLYQGEVCHY
QIRRHGEDAFFSIDDKGQTKILHGLETLVKYYQQEPNGLITKLAQPLIGDPPPPNTRSQG
VTNLLHRATSKNESKVVIELLKCGNRNFDAKNKDGQTALHLAAINCNEGILKLLLDAGVQ
VNSSDSFGWQPLHYACRKKDASFIRTLIAANANVQCRNIENGHVPLHEAAKYGNLEAVQE
LLAAHAPLLPRTSAGEFPFDLAKEAEQTAVEQFLLNYKLPPANTSRELWYHGTLKRDEAV
AILKNYAQQHAREKQAATDQPLDTSGYFLVRYSESPAASGYVLTLLGDQVVKNFLISQAD
LYQNGNKLTSNGSKYMYIDDGPYWPSLEHLVAHYMRFSYGLPVSLKYPVPPQPKPELPSF
ATIPRPKHKLRENPPISPLPSSSSKLPPALTITKKKQKENSSSMFNTLRIVSPKKSLFDM
NSLRKSKTKNKRSDSESSVSLVAAAEELQAAVPMLKNLSFSTDFSNFNVDAGDVYNVPRN
NTPIDLPPIANKTEDEVEYYTKSDVAIERERLAELTSNGYLPTTDVHMLLDQEVKQLDGK
HMLRLDSMISTGSTESEMASYLQRKCSGAAAGTIGLSSAELEAAKQRFLINRDQLELESE
IGAGEFGSVYKGWLRQANGHRLEVAIKTLRDEEQQAINKQEFLREASVMMRLAHKCIVRL
IGISKGEMLMMVQELAPLGSMLQYILDHSTEVKVNYELKLWASQIACGMHYLETQHFVHR
DLAARNILLTSRQQAKISDFGMSRSLSAGSDEYHFTQGGRWPIRWYAPESFNNGIFSHAS
DVWSFGVTLWEMFALGAPPYGDISNVDAIKLVDSGQRLPQPKICPAYIYAVMQSCWNYHP
RERPTFAYLKEFFNRGPEYQNLPELVQSVHI
Download sequence
Identical sequences B4KT54
XP_002005639.1.58863 FBpp0168179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]