SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0168448 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0168448
Domain Number 1 Region: 38-133
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000471
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0168448   Gene: FBgn0141970   Transcript: FBtr0169956
Sequence length 199
Comment type=protein; loc=scaffold_6496:complement(9222421..9222629,9222692..9223040,9223102..9223143); ID=FBpp0168448; name=DmojGI19231-PA; parent=FBgn0141970,FBtr0169956; dbxref=FlyBase:FBpp0168448,FlyBase_Annotation_IDs:GI19231-PA,GB_protein:EDW09077,REFSEQ:XP_002005142,FlyMine:FBpp0168448; MD5=28ffdefb8b698c86482035c8688e64e1; length=199; release=r1.3; species=Dmoj;
Sequence
MFLLRTFALFYLVWYARAGEIDCDKTDAVNEDHVHYCCKHPDGHSDIIDSCSKETGFKMP
SAKEQSLVDLTATRAISGTCFAKCVFEKMNVMKDDNLDMDSVKKYLNEKFSQDPEYVKEM
INAFDHCHGKSEENVAKFMSNHVFVHMSQHYCAPKSSVIMACVIRQFFHNCPKDRWAKTK
ECENLLAFSQNCRDSLATL
Download sequence
Identical sequences B4KPA1
FBpp0168448 XP_002005142.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]