SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0168471 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0168471
Domain Number 1 Region: 56-133
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000001
Family Insect pheromone/odorant-binding proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0168471   Gene: FBgn0141993   Transcript: FBtr0169979
Sequence length 203
Comment type=protein; loc=scaffold_6496:complement(8980414..8980628,8980690..8980846,8980918..8981037,8981117..8981188,8981250..8981297); ID=FBpp0168471; name=DmojGI19254-PA; parent=FBgn0141993,FBtr0169979; dbxref=FlyBase:FBpp0168471,FlyBase_Annotation_IDs:GI19254-PA,GB_protein:EDW09024,REFSEQ:XP_002005089,FlyMine:FBpp0168471; MD5=0705f0411320a9f9a4fec7d2d0dc3c73; length=203; release=r1.3; species=Dmoj;
Sequence
MQTRKVEKSAGVALLMLLMMLSPAQAAAYNCSAPPSFDNFDVNSCCRTPEINLGNVPQKC
QQHVNQLKSANPKYPAYAHLCYPECIYRETGALINGRLQMDKVREYLQEHVHRRDREVVP
HIVRSFDTCRKNIHGHLKSANLESYKVLPQGCSPYAAMLYSCVNAETFLNCPAKLWKSDE
KCLVAKEFAQQCNPLPHVPLPIS
Download sequence
Identical sequences B4KNX9
XP_002005089.1.58863 FBpp0168471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]