SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0168971 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0168971
Domain Number 1 Region: 41-133
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.96e-16
Family Insect pheromone/odorant-binding proteins 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0168971   Gene: FBgn0142491   Transcript: FBtr0170479
Sequence length 160
Comment type=protein; loc=scaffold_6496:complement(202260..202700,206918..206959); ID=FBpp0168971; name=DmojGI19754-PA; parent=FBgn0142491,FBtr0170479; dbxref=FlyBase:FBpp0168971,FlyBase_Annotation_IDs:GI19754-PA,GB_protein:EDW08093,REFSEQ:XP_002004158,FlyMine:FBpp0168971; MD5=0a3a2bd8921f7bd86822d6caa1fe5028; length=160; release=r1.3; species=Dmoj;
Sequence
MLMAMPTPTVDCGSSRYAKVEANLAVTVIEDTPRQFSADQVRLCAQQTELSLKELLQFHT
NDATNVTEATQCFTHCLYEQMGLMHDGVFVEQDLVGHLSDAINPTWWPQRACHSLRGANK
CETAHKIHQCIQQVQTEKFNLDNGKAEATASPVTETNAIN
Download sequence
Identical sequences FBpp0168971

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]