SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0169090 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0169090
Domain Number - Region: 57-126
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000824
Family Insect pheromone/odorant-binding proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169090   Gene: FBgn0142610   Transcript: FBtr0170598
Sequence length 189
Comment type=protein; loc=scaffold_6496:join(1832731..1832829,1832894..1833016,1833118..1833465); ID=FBpp0169090; name=DmojGI19873-PA; parent=FBgn0142610,FBtr0170598; dbxref=FlyBase:FBpp0169090,FlyBase_Annotation_IDs:GI19873-PA,GB_protein:EDW08267,REFSEQ:XP_002004332,FlyMine:FBpp0169090; MD5=270282bcf1c7e5a2b7721eed3c2fa3dd; length=189; release=r1.3; species=Dmoj;
Sequence
MWSSKNIVVFVLLGYGSIAYGQTIDCQKPPPLLDPALCCRDGGRDQIAEKCTEKVVGTAN
GQQNNGPPTLDTATCLADCILTTSQYKREPKSLNLEHIRNDLTAKFPNDTLYVEAMTAAF
TKCEPEAQRRLAAVQQFNPKQPKCSPFSAIVLGCAYMEYFKNCPSHRWTQSPQCVMAKTF
VTQCIVQNN
Download sequence
Identical sequences B4KR80
FBpp0169090 XP_002004332.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]