SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0169132 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0169132
Domain Number 1 Region: 50-139
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000366
Family Insect pheromone/odorant-binding proteins 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169132   Gene: FBgn0142652   Transcript: FBtr0170640
Sequence length 208
Comment type=protein; loc=scaffold_6496:join(2294587..2294637,2294701..2294895,2294999..2295379); ID=FBpp0169132; name=DmojGI19915-PA; parent=FBgn0142652,FBtr0170640; dbxref=FlyBase:FBpp0169132,FlyBase_Annotation_IDs:GI19915-PA,GB_protein:EDW08341,REFSEQ:XP_002004406,FlyMine:FBpp0169132; MD5=fc59e28c7930f18785b5ee374631e157; length=208; release=r1.3; species=Dmoj;
Sequence
MLSKSQQLLLIVGLTCWSVAQADVDCSQKPKFVNPNTCCPLPEIATPELNEKCKEYLQTP
AMQMESSAEGKRGHRHHSFLPPCYISCIFNETGIYKDNDVDIDALNDYLKNIYKDNAELE
SIATEAAGKCNAKMDEFKDKMSDRPRPSSPPGAMKCPYKPVFLVGCVLGKIMFNCPASIW
SDTQECNEARDYFKACKHHKRDRFGGDN
Download sequence
Identical sequences B4KRS1
XP_002004406.1.58863 FBpp0169132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]