SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0169487 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0169487
Domain Number 1 Region: 21-135
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.75e-25
Family Insect pheromone/odorant-binding proteins 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169487   Gene: FBgn0143006   Transcript: FBtr0170995
Sequence length 144
Comment type=protein; loc=scaffold_6496:join(8933099..8933143,8933214..8933603); ID=FBpp0169487; name=DmojGI20270-PA; parent=FBgn0143006,FBtr0170995; dbxref=FlyBase:FBpp0169487,FlyBase_Annotation_IDs:GI20270-PA,GB_protein:EDW09009,REFSEQ:XP_002005074,FlyMine:FBpp0169487; MD5=a411a96ec4fd3dce4d3ad5cfd87c5c97; length=144; release=r1.3; species=Dmoj;
Sequence
MKNTVAILLCALIGLASAAEYKLRTAEDLQKVRKECAEANKVTEALIAKYKTFEYPDDEI
TRNYIKCIFNKFDLFEDTKGFKVDNLVAQLGQGREDKTQLKADVEKCADKNEQKSPANVW
AYRGFKCFLSKNLPLVQAAIQKKN
Download sequence
Identical sequences XP_017865951.1.65068 FBpp0169487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]