SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0169529 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0169529
Domain Number 1 Region: 107-208
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000000994
Family Insect pheromone/odorant-binding proteins 0.0062
Further Details:      
 
Weak hits

Sequence:  FBpp0169529
Domain Number - Region: 71-111
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0549
Family beta-sandwich domain of Sec23/24 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169529   Gene: FBgn0143048   Transcript: FBtr0171037
Sequence length 218
Comment type=protein; loc=scaffold_6496:join(9218517..9218918,9219650..9219904); ID=FBpp0169529; name=DmojGI20312-PA; parent=FBgn0143048,FBtr0171037; dbxref=FlyBase:FBpp0169529,FlyBase_Annotation_IDs:GI20312-PA,GB_protein:EDW09075,REFSEQ:XP_002005140,FlyMine:FBpp0169529; MD5=2a0a4a84f54cd32c946c200a3b3e61e0; length=218; release=r1.3; species=Dmoj;
Sequence
MRLLLLLLLSFSCSINCLKCRSQDGAGDAELKRIVRTCMQRSGSNGNQEDNDNRRYGNGN
GRYNFDNDDYGQAQDRGQGQGRQQQQQQQQQSYGNSWQRSVKQTDNNNNNNNNNSNTSES
GGCVALCFFEEMNMVDGSGQPDRRKVSYLLTKDLRDRELRNFYMDTVQQCFRYIEHSRYS
NNNSNNKCSQARELVKCMSEYAKAQCDDWEEHGNMLFN
Download sequence
Identical sequences B4KP99
FBpp0169529 XP_002005140.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]