SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0169531 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0169531
Domain Number - Region: 43-131
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000204
Family Insect pheromone/odorant-binding proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169531   Gene: FBgn0143050   Transcript: FBtr0171039
Sequence length 200
Comment type=protein; loc=scaffold_6496:join(9221051..9221086,9221144..9221498,9221559..9221770); ID=FBpp0169531; name=DmojGI20314-PA; parent=FBgn0143050,FBtr0171039; dbxref=FlyBase:FBpp0169531,FlyBase_Annotation_IDs:GI20314-PA,GB_protein:EDW09076,REFSEQ:XP_002005141,FlyMine:FBpp0169531; MD5=49824d9afd0af12ead2fbbcbafe20c50; length=200; release=r1.3; species=Dmoj;
Sequence
MWRFIFVLALLLVYTALGIRVNCRHMERIHEDHIHYCCKHPDGHNDVSELCAQKTNFKLP
SKTEEAMEDNTVDAVMTGNCWAKCVFDHYKFLVNDTLDMLAVRSHYKSVHRLDPEYETEM
LAAFDECHSKAVEATSVFLSMPIVRAFSSANVCKPLSSVILSCVIQTFFHNCPRSRWSNT
TECLETLAFSKRCKDVLTTM
Download sequence
Identical sequences FBpp0169531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]