SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0169532 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0169532
Domain Number - Region: 88-141
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0107
Family Insect pheromone/odorant-binding proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0169532   Gene: FBgn0143051   Transcript: FBtr0171040
Sequence length 219
Comment type=protein; loc=scaffold_6496:join(9223434..9223571,9223629..9223757,9224255..9224411,9224481..9224716); ID=FBpp0169532; name=DmojGI20315-PA; parent=FBgn0143051,FBtr0171040; dbxref=FlyBase:FBpp0169532,FlyBase_Annotation_IDs:GI20315-PA,GB_protein:EDW09078,REFSEQ:XP_002005143,FlyMine:FBpp0169532; MD5=74ef489223888ff56de2f17588b24cef; length=219; release=r1.3; species=Dmoj;
Sequence
MRYPIFLSLLLLLPLLGLVQAQDISEEEVAEASPIDNLTLDQCDKKRRGCCSDLYLGDDE
TLMKCFSIHSDRLPAEGDTDMSKTLKFLSCFVECLYKQRKYVGKSDTINMKMVKLDAEIL
YADRPKEQAYHIKMFDYCRKDAMNLYNLLKASPGAKAMLKNACRPFLLMVYLCQSEYHKK
HECPYFRWEGREKSNTKKSCHDAKIKCYELDGVPAPVEH
Download sequence
Identical sequences B4KPA2
FBpp0169532 XP_002005143.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]