SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0170159 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0170159
Domain Number 1 Region: 2-105
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.31e-17
Family Insect pheromone/odorant-binding proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0170159   Gene: FBgn0143676   Transcript: FBtr0171667
Sequence length 108
Comment type=protein; loc=scaffold_6496:18417051..18417377; ID=FBpp0170159; name=DmojGI20942-PA; parent=FBgn0143676,FBtr0171667; dbxref=FlyBase:FBpp0170159,FlyBase_Annotation_IDs:GI20942-PA,GB_protein:EDW10182,REFSEQ:XP_002006247,FlyMine:FBpp0170159; MD5=66dde9f83f18d888aed5e55a01c5dfd7; length=108; release=r1.3; species=Dmoj;
Sequence
MDEMVTKCLTDNDIEKAEYETLLSQNNSNIDMDSIDKKYKCYLHCMATEMHILDSNGHVD
IELVNEHEELTPKDREVFVECKKIHDGGEDFCEYAFSMTMCLLESLES
Download sequence
Identical sequences FBpp0170159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]