SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0170299 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0170299
Domain Number 1 Region: 23-133
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 4.84e-27
Family Insect pheromone/odorant-binding proteins 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0170299   Gene: FBgn0143814   Transcript: FBtr0171807
Sequence length 138
Comment type=protein; loc=scaffold_6496:join(20992907..20992966,20993404..20993760); ID=FBpp0170299; name=DmojGI21082-PA; parent=FBgn0143814,FBtr0171807; dbxref=FlyBase:FBpp0170299,FlyBase_Annotation_IDs:GI21082-PA,GB_protein:EDW10432,REFSEQ:XP_002006497,FlyMine:FBpp0170299; MD5=17ed6c51f8b4e8fb0876eb51aa50d8bb; length=138; release=r1.3; species=Dmoj;
Sequence
MNPIFVIALTALFVAMAVATPVELTDEQKKLIKQHVAQCAEEVKLTEEEIARVKAKDFTN
PSENMKCFANCFYEKTGTLKDGVVQEEVVLKKLGAIIGEEKTRQALTKCSGIKGENKCDT
ANKLYQCFESFNPVEIKA
Download sequence
Identical sequences B4KRK6
XP_002006497.1.58863 FBpp0170299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]