SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0170300 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0170300
Domain Number 1 Region: 19-126
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.96e-25
Family Insect pheromone/odorant-binding proteins 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0170300   Gene: FBgn0143815   Transcript: FBtr0171808
Sequence length 130
Comment type=protein; loc=scaffold_6496:join(21017269..21017322,21017520..21017858); ID=FBpp0170300; name=DmojGI21083-PA; parent=FBgn0143815,FBtr0171808; dbxref=FlyBase:FBpp0170300,FlyBase_Annotation_IDs:GI21083-PA,GB_protein:EDW10436,REFSEQ:XP_002006501,FlyMine:FBpp0170300; MD5=1d6c95d539476d4232f8eaa6dc54948f; length=130; release=r1.3; species=Dmoj;
Sequence
MKLLIVLMGFLAMALAADLTAEQRSTIRANAMQCTQQEGNTKEQAIALRNGNFEDADDKV
KCYANCFLERAGFIVEGQINGDAVLQKLAPAAGADQVKAALATCASIKGANKCDTGFQIY
RCFYRNRAWA
Download sequence
Identical sequences B4KRL0
FBpp0170300 XP_002006501.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]