SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0170304 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0170304
Domain Number 1 Region: 19-129
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 3.4e-21
Family Insect pheromone/odorant-binding proteins 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0170304   Gene: FBgn0143819   Transcript: FBtr0171812
Sequence length 135
Comment type=protein; loc=scaffold_6496:join(21109245..21109301,21109377..21109727); ID=FBpp0170304; name=DmojGI21087-PA; parent=FBgn0143819,FBtr0171812; dbxref=FlyBase:FBpp0170304,FlyBase_Annotation_IDs:GI21087-PA,GB_protein:EDW10440,REFSEQ:XP_002006505,FlyMine:FBpp0170304; MD5=e4b7b13fc5e87465e25c0aa35bdc03f0; length=135; release=r1.3; species=Dmoj;
Sequence
MKAILCAATLLVIAISAVQCNPNFQQLMKQCMDETKLTEAELKEFMGSGMNGNANENLKC
YSKCLMEKQGHLVNGQFNSEALLNTLKNVPQMKDKMAEITSGVNACKDMKGTNDCDTAFK
VFMCLKEHKAVMGGQ
Download sequence
Identical sequences B4KRL4
XP_002006505.1.58863 FBpp0170304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]