SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0170993 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0170993
Domain Number 1 Region: 303-493
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.14e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.00000617
Further Details:      
 
Domain Number 2 Region: 72-146
Classification Level Classification E-value
Superfamily SH2 domain 3.1e-22
Family SH2 domain 0.00074
Further Details:      
 
Domain Number 3 Region: 239-296
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.57e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0170993   Gene: FBgn0144506   Transcript: FBtr0172501
Sequence length 500
Comment type=protein; loc=scaffold_6359:join(3488789..3488873,3488931..3490064,3490131..3490236,3490306..3490483); ID=FBpp0170993; name=DmojGI21776-PA; parent=FBgn0144506,FBtr0172501; dbxref=FlyBase:FBpp0170993,FlyBase_Annotation_IDs:GI21776-PA,GB_protein:EDW06515,REFSEQ:XP_002010860,FlyMine:FBpp0170993; MD5=ed68389201fe3807a3207a5f6c3ef0d3; length=500; release=r1.3; species=Dmoj;
Sequence
MPKTAGVVATLAGGGEPSSPVQKVWKPELYKIQLDAPAPHPVRCQRTLPLPPANSTADAV
EDNSQAVRLYGSEYHGVMGHLEAEQLLANAPDGSYLVRRSPKTDGYYTLSVRFNKRCKHF
KVFHKPGSGHHLREQDKHYETVHEMVADGLINFHMQLYASPIIQQINQQTKNCYQQSPYM
TLNRRKLRALSNELGKSASVDTSDAAAPMPSVQDSSPQPQQDQQQQQQQQLPQQDPMPLV
YEKPHNFKVHTFKGLNWCEFCANFLWGFTAQGVKCDACGFMAHNKCSELVPPKCVPDLKC
IRGVFGTDLTTMVQLHQCNIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIDALKLALDR
DGEKTDMSEGAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAARSGSPAEQLQLMAE
AVRRLPPAHFNCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNLTEEIF
MLSSLITHCEKVFASSSRKQ
Download sequence
Identical sequences B4L5Q6
FBpp0170993 XP_002010860.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]