SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0171361 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0171361
Domain Number 1 Region: 38-94
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 0.0000863
Family Antifungal peptide scarabaecin 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0171361   Gene: FBgn0144873   Transcript: FBtr0172869
Sequence length 99
Comment type=protein; loc=scaffold_6540:complement(29929076..29929375); ID=FBpp0171361; name=DmojGI22144-PA; parent=FBgn0144873,FBtr0172869; dbxref=FlyBase:FBpp0171361,FlyBase_Annotation_IDs:GI22144-PA,GB_protein:EDW16582,REFSEQ:XP_002001121,FlyMine:FBpp0171361; MD5=9f23b4ad4ba5d7e1d2bc16ae4fc594e2; length=99; release=r1.3; species=Dmoj;
Sequence
MNSLYLFAVCLALASCCLANPWGKPTGQPGCQTEEELAVGAYRHYYRKNQYWVCQVLGVA
ASPAYCPIAQAWLDDVKACVPYSEWYWTPTVAPPSQPLA
Download sequence
Identical sequences B4K8Y5
FBpp0171361 XP_002001121.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]