SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0171545 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0171545
Domain Number 1 Region: 7-195,298-436,636-670,705-746
Classification Level Classification E-value
Superfamily ARM repeat 7.41e-28
Family Armadillo repeat 0.041
Further Details:      
 
Domain Number 2 Region: 830-913
Classification Level Classification E-value
Superfamily POZ domain 0.0000596
Family BTB/POZ domain 0.022
Further Details:      
 
Weak hits

Sequence:  FBpp0171545
Domain Number - Region: 226-270
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00877
Family Insect pheromone/odorant-binding proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0171545   Gene: FBgn0145056   Transcript: FBtr0173053
Sequence length 987
Comment type=protein; loc=scaffold_6540:complement(26948174..26949115,26949215..26949290,26949352..26949902,26949968..26950174,26950230..26950568,26950632..26951225,26951285..26951539); ID=FBpp0171545; name=DmojGI22328-PA; parent=FBgn0145056,FBtr0173053; dbxref=FlyBase:FBpp0171545,FlyBase_Annotation_IDs:GI22328-PA,GB_protein:EDW16256,REFSEQ:XP_002000795,FlyMine:FBpp0171545; MD5=a861038646bb2aabdad5c04703d28a78; length=987; release=r1.3; species=Dmoj;
Sequence
MLWSLEQVEGMLSVLKTSTDKTVVYKCLVKLRTDLIKSKDGIVLFRTAGGVPVMVRLISK
LNEKIMEVVLSILGNCCTDDQSCVEAVDCKVISPLITILKTVPNPIIQCRACRMLGNMAK
NKKASSFLNVHYGAIAPAICHIIESTSAVQTKIMAFRVCRNLLVSPQFYKPFLASNGFLQ
LMHIFVAVMKNNEAPKASEQNAVDVSALVGLKRNQHREKYFEEVARNLEGVRSDIFDYQM
LKNSTRNCEYVLPKENDAIELAYEILKCLMLLSAQQIGMKAWEVLSRNTSLAPIVYFVKE
DSEQRASALKILSNFCKDPYAFYMLSTADAIVAACELLMAVNMAKPLSESESRHCVNIIA
TLSVDACSRSKIRRCGALRKLVAMIRDSHSQSERSSLFHILNNFQYDNLSMEMLLYEGLV
PMLVRELNDYLTSDEEYHKRRREERIQGGKKRKLTDPTTPETLSKFSKTQEPLNLDFDSP
SSSPRSYRTTSPCSSRSMSPVCSNLFANDDDENYSPACSDDDDDEDDSKASSGNMDTRES
RIASNRAQPANVMDILKLIDEGSETIDDTLSDKEDMEELSSDVPPKLAQLRSQAGDTIDI
IENLIYRITLMINKRPELGKPETLDTLIRAINLFGANNNFANALTNILLESQFFAQIIKH
GVVHQLYQLTKVEEMRKDGFAFLETLTNVGESNYGKEELVRLLRCESDLNAQQRAAISVA
YIIKSHRLLYQFLYDGNALTLLFDLLLRKKSDNLYADEAADAVTAMSRFTLGIVLPKPEQ
VDSSSSICLNQMNATNIPLHEHCDMRFLLPSENVDGKDAESRTTLSIGFNKQLLCETSEV
FNKMLNSDFREGHDGEIQLRDYTANGLRYFLHLISCQERHLVMPDYGALLQAFEMSRVYI
IPELEALLHERLIQFLDSRNCLRLLEWALKNYHAELTETAISYYLCASLPAQDKLQLFRA
AEDSVYASEWFQLLNDAVYERCRSTGY
Download sequence
Identical sequences B4K619
FBpp0171545 XP_002000795.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]