SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0171552 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0171552
Domain Number 1 Region: 31-148
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 5.1e-30
Family Insect pheromone/odorant-binding proteins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0171552   Gene: FBgn0145063   Transcript: FBtr0173060
Sequence length 154
Comment type=protein; loc=scaffold_6540:complement(26858278..26858742); ID=FBpp0171552; name=DmojGI22335-PA; parent=FBgn0145063,FBtr0173060; dbxref=FlyBase:FBpp0171552,FlyBase_Annotation_IDs:GI22335-PA,GB_protein:EDW16239,REFSEQ:XP_002000778,FlyMine:FBpp0171552; MD5=e62a886f04b32a620e702a4cc303b828; length=154; release=r1.3; species=Dmoj;
Sequence
MKLFILLLSLTLAFADHHEGHSHDHDHGSGYVVKTHEDLVRFRNICAEQVHASAEDVAKY
VKWDFADEEKSRCYLKCIFEHFGLFDATHGFDVHKIHEQLAGGSHVDHADEVHQKIADCA
DNNAQGSDACTWAYRGGMCFMRSNLQLVQQSVKA
Download sequence
Identical sequences B4K602
FBpp0171552 XP_002000778.1.58863 XP_017866839.1.65068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]