SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0171814 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0171814
Domain Number 1 Region: 583-724
Classification Level Classification E-value
Superfamily PH domain-like 3.28e-44
Family Phosphotyrosine-binding domain (PTB) 0.0000319
Further Details:      
 
Domain Number 2 Region: 444-571
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-23
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0171814   Gene: FBgn0145325   Transcript: FBtr0173322
Sequence length 735
Comment type=protein; loc=scaffold_6540:complement(22190127..22192334); ID=FBpp0171814; name=DmojGI22597-PA; parent=FBgn0145325,FBtr0173322; dbxref=FlyBase:FBpp0171814,FlyBase_Annotation_IDs:GI22597-PA,GB_protein:EDW15769,REFSEQ:XP_002000308,FlyMine:FBpp0171814; MD5=f23a2e859e292a4691c57dd7e15c3850; length=735; release=r1.3; species=Dmoj;
Sequence
MFNQSFGIRETMRSVYEDSAAVSTDSSKYHTSYSYNSQTNSNNNNYHKNYNGNNNGNGIP
YHARENSLPFSYGNAKAATPLRKTPTPTRADSFLDFDFGLSSKSNGSTNNNNNNNNYNSS
SSTGSDMIKPQPRLTSPLLVRKTLGGSRSNTNGNTNGSNTNTVISNTYHYGSATGVPKPR
VDLEQLLGERRDKVFSEYRVREKERELERELERATARVPPTPPQRRQSNGLSHNKYNYDF
EFNLNLNDINDRSSLPAPATAPAPYTTRNIEFRQDMDVPDGAIGGTSRRLESTLVERNYH
TINNSSRSISRGNNYNNYHSLERPPMEVTYKQLAEPQLEQQASIYGQNQLHLETHTRSRR
DLSPIYAIRTKRNAATAAAAPNSNGHQVQIQQQQQADYLLTPSPTSRPETPAFPVTPRTP
FGSSSLQRASPTTESIYQTMATNRQRLNSAPSPTFEVAPDLVKFARNSAKFWYKPMLSRE
DAIALLMNAPPGTFLVRDSTTYANAYGLVLRVAQPPAGSQELVRHFLIEPTQRGVHLKGC
DNEPTFTSLSALIYEHSINKLALPCLLRIPDEDVVPGLASTTPAQQHLLTHGAATNVLWL
YSCDTESLTGNEAIRKAIRQMYAQKELPTPTEVHFKVTGQGITLTDNTRKKFFRKHYTAD
VISHCAIDPDNRTWNYNGNEADKKTIFAFVARRSHSSKDNQCHVFCELSVAQPAAAIVSF
ANRTLPVEKQRNYVL
Download sequence
Identical sequences B4KB65
FBpp0171814 XP_002000308.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]