SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0172186 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172186
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.83e-65
Family BAR domain 0.000000782
Further Details:      
 
Domain Number 2 Region: 286-361
Classification Level Classification E-value
Superfamily SH3-domain 6.43e-23
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172186   Gene: FBgn0145696   Transcript: FBtr0173694
Sequence length 367
Comment type=protein; loc=scaffold_6540:complement(14961834..14962937); ID=FBpp0172186; name=DmojGI22969-PA; parent=FBgn0145696,FBtr0173694; dbxref=FlyBase:FBpp0172186,FlyBase_Annotation_IDs:GI22969-PA,GB_protein:EDW15088,REFSEQ:XP_001999627,FlyMine:FBpp0172186; MD5=d1cf9059590d34a83ac6ccd01ae5f356; length=367; release=r1.3; species=Dmoj;
Sequence
MAFAGLKKQINKANQYMTEKMGGAEGTKLDMDFMDMERKTDVTVELVEELQLKTKEFLQP
NPTARAKMAAVKGISKLSGQAKSNTYPQPEGLLAECMLTYGKKLGEDNSVFAQALVEFGE
ALKQMADVKYSLDDNIKQNFLEPLHHMQTKDLKEVMHHRKKLQGRRLDFDCKRRRQAKDD
EIRGAEEKFAESLQLAQVSMFNLLENDTEHVSQLVTFAEALYDFHSQCADVLRGLQETLQ
EKRAEAESRPRNEFVPKTLLDLNLDGGGGGLIDDGTPSHISSSASPLPSPMRSPAKSMAA
TPHRQQQPCCQALYDFDPENPGELGFKENDIITLLNRVDDNWYEGAVNGRTGYFPQSYVQ
VQVPLPN
Download sequence
Identical sequences B4K588
XP_001999627.1.58863 XP_015022464.1.58863 XP_015022465.1.58863 XP_017873588.1.65068 XP_017873589.1.65068 XP_017873590.1.65068 FBpp0172186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]