SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0172396 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172396
Domain Number 1 Region: 24-140
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 4.32e-28
Family Insect pheromone/odorant-binding proteins 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172396   Gene: FBgn0145906   Transcript: FBtr0173904
Sequence length 147
Comment type=protein; loc=scaffold_6540:complement(11212889..11213269,11213330..11213392); ID=FBpp0172396; name=DmojGI23179-PA; parent=FBgn0145906,FBtr0173904; dbxref=FlyBase:FBpp0172396,FlyBase_Annotation_IDs:GI23179-PA,GB_protein:EDW14683,REFSEQ:XP_001999222,FlyMine:FBpp0172396; MD5=d2f21f3ba42b9a5dcd463345b34eba0b; length=147; release=r1.3; species=Dmoj;
Sequence
MKVNALLISIAVVLATVAVGQVSAKFTIRTHEDAVEAHEECQEKYNVPEDIYEQYLNYVF
PEHRRTACYVKCFVEKMGLFDEKKGFNEKAIIAQFTAQNYKDLESVRHGLEKCIDHNEAE
SDVCTWANRVFSCWLPINRHVVRKIYN
Download sequence
Identical sequences B4KB05
XP_001999222.1.58863 FBpp0172396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]