SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0172397 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172397
Domain Number 1 Region: 9-130
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000000017
Family Insect pheromone/odorant-binding proteins 0.0088
Further Details:      
 
Domain Number 2 Region: 133-229
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000772
Family Insect pheromone/odorant-binding proteins 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172397   Gene: FBgn0145907   Transcript: FBtr0173905
Sequence length 237
Comment type=protein; loc=scaffold_6540:complement(11211870..11212541,11212608..11212649); ID=FBpp0172397; name=DmojGI23180-PA; parent=FBgn0145907,FBtr0173905; dbxref=FlyBase:FBpp0172397,FlyBase_Annotation_IDs:GI23180-PA,GB_protein:EDW14682,REFSEQ:XP_001999221,FlyMine:FBpp0172397; MD5=0d1e2c289f214c494bab786706f635dc; length=237; release=r1.3; species=Dmoj;
Sequence
MRLAVGLLTLWLAVALADLTGDAQILEKCLGSISSPERIESDLRKLAKYASWTSEEVPCL
MRCLASEKGWFDIDANKWHKQRVAEELGADIYNYCHYELRRKSRDACSYAHRGLRCLKQA
ELHAGNSISTLMQCSGQLNATNVQMLQYSTLKPKESIPCLFQCFADAMGFYDEAGNWRLL
NWQQAFGPTHQEHQPDYSLCRLSDEQRSQASSKCAWMYDEYLCWERLNGNLNGTNLV
Download sequence
Identical sequences B4KB04
XP_001999221.1.58863 FBpp0172397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]