SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0172403 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172403
Domain Number 1 Region: 34-148
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 4.45e-34
Family Insect pheromone/odorant-binding proteins 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172403   Gene: FBgn0145913   Transcript: FBtr0173911
Sequence length 149
Comment type=protein; loc=scaffold_6540:complement(11081038..11081055,11081118..11081374,11081509..11081584,11082357..11082455); ID=FBpp0172403; name=DmojGI23186-PA; parent=FBgn0145913,FBtr0173911; dbxref=FlyBase:FBpp0172403,FlyBase_Annotation_IDs:GI23186-PA,GB_protein:EDW14676,REFSEQ:XP_001999215,FlyMine:FBpp0172403; MD5=c2d3e584aa1c82bf881276c9222e350c; length=149; release=r1.3; species=Dmoj;
Sequence
MSLRATINIFHILLLCSVMGRGIWAAELRRDETYPPPELLKELQPVHDSCVGKTGVTEAA
IKEFSDGEVHEDEKLKCYMYCVFDETDVLHEDGEVHLEKLLDRLPDSMHDIAVNMGKRCL
YPKGDTKCERAFWLHRCWKQADPKHYFLI
Download sequence
Identical sequences B4KAZ8
FBpp0172403 XP_001999215.1.58863 XP_017856429.1.65068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]