SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0172405 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172405
Domain Number 1 Region: 46-158
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.2e-32
Family Insect pheromone/odorant-binding proteins 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172405   Gene: FBgn0145915   Transcript: FBtr0173913
Sequence length 158
Comment type=protein; loc=scaffold_6540:complement(11076656..11076673,11076739..11076995,11077113..11077188,11077252..11077377); ID=FBpp0172405; name=DmojGI23188-PA; parent=FBgn0145915,FBtr0173913; dbxref=FlyBase:FBpp0172405,FlyBase_Annotation_IDs:GI23188-PA,GB_protein:EDW14675,REFSEQ:XP_001999214,FlyMine:FBpp0172405; MD5=0d7bea9c2b75bbd43caa173e1d062a8c; length=158; release=r1.3; species=Dmoj;
Sequence
MALSDFGQNRGRRPVAACLLIALSLVFSEALLSPALAQRDEDYPPRNVLKMSKLFHDICV
EQTGVSEAAIKEFSDGEIHDDEKLKCYMNCLFHEFEVVDDDGDVHLEKLFSSVPHSIRDN
LMAMSQECIHPIGDTLCHKAWWFHQCWKKADPKHYFLP
Download sequence
Identical sequences FBpp0172405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]