SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0172623 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172623
Domain Number 1 Region: 16-134
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 2.49e-31
Family Insect pheromone/odorant-binding proteins 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172623   Gene: FBgn0146132   Transcript: FBtr0174131
Sequence length 142
Comment type=protein; loc=scaffold_6540:complement(7658413..7658802,7658862..7658900); ID=FBpp0172623; name=DmojGI23406-PA; parent=FBgn0146132,FBtr0174131; dbxref=FlyBase:FBpp0172623,FlyBase_Annotation_IDs:GI23406-PA,GB_protein:EDW14311,REFSEQ:XP_001998850,FlyMine:FBpp0172623; MD5=4ae64fe5fa96940bb45861805a98cff1; length=142; release=r1.3; species=Dmoj;
Sequence
MKYLVAICMLVGLVSSEYVIKNKEDMLSYREACVKELKIPNELVEQYQKWVYPNDAQTQC
YLKCVFTKFGLFDNQSGYNVENIHTQLSRGHANHDDVLHGQIEACLDKNEQGSNACEWAY
RGADCLLKNHLKLVQQSLAPKS
Download sequence
Identical sequences B4K7X7
FBpp0172623 XP_001998850.1.58863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]