SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0172710 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172710
Domain Number 1 Region: 62-157
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000183
Family Insect pheromone/odorant-binding proteins 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172710   Gene: FBgn0146219   Transcript: FBtr0174218
Sequence length 171
Comment type=protein; loc=scaffold_6540:complement(6231387..6231481,6231543..6231669,6231730..6231791,6231851..6232082); ID=FBpp0172710; name=DmojGI23493-PA; parent=FBgn0146219,FBtr0174218; dbxref=FlyBase:FBpp0172710,FlyBase_Annotation_IDs:GI23493-PA,GB_protein:EDW14151,REFSEQ:XP_001998690,FlyMine:FBpp0172710; MD5=d3fc20c7d5bf3e0f803477a0dab8e3da; length=171; release=r1.3; species=Dmoj;
Sequence
MFPISVALLSTLSLSGGLVSALSDRAKDNGDIFIINYDSFDGDVDDISTTTEAPRDPDYI
DFDAIMHGCNASFITTMSNVLQFNNTGKLADETDLTSMCYFRCFFEKAGLVENFRLVPNI
VRKYMWPATGDSIEYCESQGINEQNACKRTYAIAQCAMMRALTDARNKPMV
Download sequence
Identical sequences FBpp0172710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]