SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0172943 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0172943
Domain Number 1 Region: 70-162
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000353
Family Insect pheromone/odorant-binding proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0172943   Gene: FBgn0146451   Transcript: FBtr0174451
Sequence length 190
Comment type=protein; loc=scaffold_6540:complement(2434719..2434915,2434973..2435129,2435243..2435380,2435439..2435519); ID=FBpp0172943; name=DmojGI23726-PA; parent=FBgn0146451,FBtr0174451; dbxref=FlyBase:FBpp0172943,FlyBase_Annotation_IDs:GI23726-PA,GB_protein:EDW13728,REFSEQ:XP_001998267,FlyMine:FBpp0172943; MD5=3f6a316a0dda6377a199bee23d22fda8; length=190; release=r1.3; species=Dmoj;
Sequence
MLLLSIFKIDSTSNKLNSCDTTKHTKLLGSCCNVPRNDQYSKACRQSLLSKANRTTNNAD
TRNLKSDKVALHACMAECVFKKNGFLYSNGTVNLSVMQRSLEQRYKKDAALAKLVAKSLN
SCADYAKTRTKQFEWLHAKDNCDYYPATLLACIMEQVYQNCPASLWKNTEDCAAMKKFLI
ACDDVKKTRK
Download sequence
Identical sequences B4KCB9
XP_001998267.1.58863 FBpp0172943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]