SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0173150 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0173150
Domain Number 1 Region: 456-717
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.23e-76
Family Protein kinases, catalytic subunit 0.0000000795
Further Details:      
 
Domain Number 2 Region: 355-495
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-36
Family SH2 domain 0.0000128
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0173150   Gene: FBgn0146658   Transcript: FBtr0174658
Sequence length 728
Comment type=protein; loc=scaffold_6540:join(3713782..3714141,3714849..3715564,3715789..3716008,3716078..3716346,3716416..3716577,3716654..3716849,3717042..3717128,3717185..3717361); ID=FBpp0173150; name=DmojGI23933-PA; parent=FBgn0146658,FBtr0174658; dbxref=FlyBase:FBpp0173150,FlyBase_Annotation_IDs:GI23933-PA,GB_protein:EDW13842,REFSEQ:XP_001998381,FlyMine:FBpp0173150; MD5=538c68808b459b751463aa12998dbe8f; length=728; release=r1.3; species=Dmoj;
Sequence
MNSHATATQNGQSTVVGHHRGYSQPSIAATAATAASGGTAGDPWYLQATGHQMPPTAPLR
HNKRPAPQPNSLGVVGVGVGVGVGAAATLLHQQQLSQSQPHIMPPSIPPHHHHHHRENNA
HQTASAATAATALHLSSHALNSHNLINNHSPKSPNQTQQQQQQTTTIQQQQQQQHSILST
FAPATAAAAAATHVQAEQAAVAAASVTAAAVAAVTQQQQQQHMQMLANCSSSNNLMSSSL
TLQAPVGVLPPKSLALSSSNSATSNSTSLPPTVAGSGSATSNSINNNNTANSNCSTGNST
TGMSTSLHSFDINGSVGAGTMDKWASSSTTAMNHASLSPTGAPQQHHLRKCEVKLNAMPW
FHGSITRDEAEHLLQPREDGLFLVRESTNFPGDYTLCVCFQGKVEHYRVKYLENKLTIDD
EEYFENLGQLVAHYEADADGLCTQLVKCLPKLGKQEYCINSKEFVDKGWVIPESELQLRE
SIGKGEFGDVLLGILRNEKVAVKMLKDEGAVQKFLAEASVMTTLEHENLVKFIGLVFTSK
HLYLVTEYMSKGSLVDYLRSRGRQHITKKDQINFAFDTASGMEYLEAKKVVHRDLAARNV
LISEDCVAKVSDFGLAREECYNLDVGKLPIKWTAPEALKNGRFSNKSDMWSFGILLWEIY
SFGRVPYPRIPLADVVKHVEVGYKMEAPEGCPAEIYEMMRQAWDLNPVKRPTFAELKVKL
QQLNNATA
Download sequence
Identical sequences FBpp0173150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]