SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0173204 from Drosophila mojavensis 1.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0173204
Domain Number 1 Region: 386-532
Classification Level Classification E-value
Superfamily PH domain-like 1.5e-38
Family Phosphotyrosine-binding domain (PTB) 0.0000564
Further Details:      
 
Domain Number 2 Region: 261-378
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-20
Family SH2 domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0173204   Gene: FBgn0146711   Transcript: FBtr0174712
Sequence length 541
Comment type=protein; loc=scaffold_6540:4328242..4329867; ID=FBpp0173204; name=DmojGI23987-PA; parent=FBgn0146711,FBtr0174712; dbxref=FlyBase:FBpp0173204,FlyBase_Annotation_IDs:GI23987-PA,GB_protein:EDW13931,REFSEQ:XP_001998470,FlyMine:FBpp0173204; MD5=eb8a83e80d405c3783d05304bab830a3; length=541; release=r1.3; species=Dmoj;
Sequence
MASVCEPSVPLNRVVQGSAFETDPDPDPDPDNIPYHAREDALPFTYGNVPVGFNTSDLHH
VETNEPTGISDKSVQIKNAASHSLPRKSVRPSISASCPLVRKTPSRQEFEDMLMERKVHV
EDANRALARKLAQDETIQRDLDELHKRLNSPLLERKAIREELIESTDLPDAELGSPSKGR
SPELQLVEKSRSKTPTFPYVQRPLNSERCVSPYPTPKPAKTLMFDDGSELHHGERAPPQA
DVFVNHTKEVEPHLVKFAKDSSHFWYKPNMSRDEAVDLLRDARPGTFLIRNSTTYRNAFG
LVLRVAKPPPGVVTGPGYGDQLVRHFLLEPTNRGVRLMGCSNEPIFTSLSAFVYEHSINQ
MSLPTTLIIPDRDLLLISNNEELILSQKQVLAQGAACNVLYLFQHNMESLTGDDAVRKAV
NEMYSAPTAPVPLEVHIKISEQGITLTDNTRKKFFRRHYPAKNISHFSMDPGNHFWSVPA
SDEGLQRSVNKSIFAFVARPLTGSKDNQCHIFCDLSSMQPASAIVSFAHKVLPLNHNCKM
L
Download sequence
Identical sequences FBpp0173204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]